| Name | SLC25A25 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6787 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC25A25 Blocking Peptide |
| Description | Rabbit polyclonal SLC25A25 antibody |
| Gene | SLC25A25 |
| Supplier Page | Shop |