| Name | NT5DC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4565 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NT5DC2 antibody was raised using the N terminal of NT5DC2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV |
| Purity/Format | Affinity purified |
| Blocking Peptide | NT5DC2 Blocking Peptide |
| Description | Rabbit polyclonal NT5DC2 antibody raised against the N terminal of NT5DC2 |
| Gene | NT5DC2 |
| Supplier Page | Shop |