| Name | Motilin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6243 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Motilin antibody was raised using the middle region of MLN corresponding to a region with amino acids LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | Motilin Blocking Peptide |
| Description | Rabbit polyclonal Motilin antibody raised against the middle region of MLN |
| Gene | MLN |
| Supplier Page | Shop |