| Name | RGS9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1649 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RGS9 Blocking Peptide |
| Description | Rabbit polyclonal RGS9 antibody raised against the N terminal of RGS9 |
| Gene | RGS9 |
| Supplier Page | Shop |