| Name | Prodynorphin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4021 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Prodynorphin antibody was raised using the middle region of PDYN corresponding to a region with amino acids SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE |
| Purity/Format | Affinity purified |
| Blocking Peptide | Prodynorphin Blocking Peptide |
| Description | Rabbit polyclonal Prodynorphin antibody raised against the middle region of PDYN |
| Gene | PDYN |
| Supplier Page | Shop |