| Name | CIB3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3124 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG |
| Purity/Format | Affinity purified |
| Blocking Peptide | CIB3 Blocking Peptide |
| Description | Rabbit polyclonal CIB3 antibody raised against the N terminal of CIB3 |
| Gene | CIB3 |
| Supplier Page | Shop |