| Name | C1QTNF1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7173 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C1QTNF1 antibody was raised using the N terminal of C1QTNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1QTNF1 Blocking Peptide |
| Description | Rabbit polyclonal C1QTNF1 antibody raised against the N terminal of C1QTNF1 |
| Gene | C1QTNF1 |
| Supplier Page | Shop |