| Name | C19ORF47 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3316 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C19ORF47 antibody was raised using the C terminal Of C19Orf47 corresponding to a region with amino acids DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | C19ORF47 Blocking Peptide |
| Description | Rabbit polyclonal C19ORF47 antibody raised against the C terminal Of C19Orf47 |
| Gene | C19orf47 |
| Supplier Page | Shop |