| Name | NIPA2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6819 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV |
| Purity/Format | Affinity purified |
| Blocking Peptide | NIPA2 Blocking Peptide |
| Description | Rabbit polyclonal NIPA2 antibody raised against the middle region of NIPA2 |
| Gene | NIPA2 |
| Supplier Page | Shop |