| Name | LYZL6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5463 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LYZL6 Blocking Peptide |
| Description | Rabbit polyclonal LYZL6 antibody raised against the N terminal of LYZL6 |
| Gene | LYZL6 |
| Supplier Page | Shop |