Name | ASB6 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5879 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV |
Purity/Format | Affinity purified |
Blocking Peptide | ASB6 Blocking Peptide |
Description | Rabbit polyclonal ASB6 antibody raised against the middle region of ASB6 |
Gene | ASB6 |
Supplier Page | Shop |