| Name | ASB6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5879 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ASB6 Blocking Peptide |
| Description | Rabbit polyclonal ASB6 antibody raised against the middle region of ASB6 |
| Gene | ASB6 |
| Supplier Page | Shop |