| Name | MRPL28 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2418 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MRPL28 Blocking Peptide |
| Description | Rabbit polyclonal MRPL28 antibody raised against the middle region of MRPL28 |
| Gene | MRPL28 |
| Supplier Page | Shop |