Name | MRPL28 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2418 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK |
Purity/Format | Affinity purified |
Blocking Peptide | MRPL28 Blocking Peptide |
Description | Rabbit polyclonal MRPL28 antibody raised against the middle region of MRPL28 |
Gene | MRPL28 |
Supplier Page | Shop |