GNAI2 antibody

Name GNAI2 antibody
Supplier Fitzgerald
Catalog 70R-5719
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL
Purity/Format Affinity purified
Blocking Peptide GNAI2 Blocking Peptide
Description Rabbit polyclonal GNAI2 antibody
Gene GNAI2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.