| Name | OMP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2611 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | OMP Blocking Peptide |
| Description | Rabbit polyclonal OMP antibody raised against the middle region of OMP |
| Gene | OMP |
| Supplier Page | Shop |