| Name | TMEM115 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7397 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM115 Blocking Peptide |
| Description | Rabbit polyclonal TMEM115 antibody raised against the N terminal of TMEM115 |
| Gene | TMEM115 |
| Supplier Page | Shop |