Name | Copine IV antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2258 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG |
Purity/Format | Affinity purified |
Blocking Peptide | Copine IV Blocking Peptide |
Description | Rabbit polyclonal Copine IV antibody raised against the C terminal of CPNE4 |
Gene | CPNE4 |
Supplier Page | Shop |