Name | NOV antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1714 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | NOV antibody was raised using the middle region of NOV corresponding to a region with amino acids RNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | NOV Blocking Peptide |
Description | Rabbit polyclonal NOV antibody raised against the middle region of NOV |
Gene | NOV |
Supplier Page | Shop |