| Name | NOV antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1714 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NOV antibody was raised using the middle region of NOV corresponding to a region with amino acids RNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NOV Blocking Peptide |
| Description | Rabbit polyclonal NOV antibody raised against the middle region of NOV |
| Gene | NOV |
| Supplier Page | Shop |