Metaxin 2 antibody

Name Metaxin 2 antibody
Supplier Fitzgerald
Catalog 70R-2450
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
Purity/Format Affinity purified
Blocking Peptide Metaxin 2 Blocking Peptide
Description Rabbit polyclonal Metaxin 2 antibody raised against the N terminal of MTX2
Gene MTX2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.