Estrogen-Related Receptor Gamma antibody

• Supplier: Fitzgerald
• Catalog: 70R-2648
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Estrogen-Related Receptor Gamma antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
• Purity/Format: Affinity purified
• Blocking Peptide: Estrogen-Related Receptor Gamma Blocking Peptide
• Description: Rabbit polyclonal Estrogen-Related Receptor Gamma antibody raised against the N terminal of ESRRG
• Gene: ESRRG