| Name | ACOT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3930 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACOT2 antibody was raised using the middle region of ACOT2 corresponding to a region with amino acids SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACOT2 Blocking Peptide |
| Description | Rabbit polyclonal ACOT2 antibody raised against the middle region of ACOT2 |
| Gene | ACOT7 |
| Supplier Page | Shop |