| Name | WDR1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3385 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | WDR1 Blocking Peptide |
| Description | Rabbit polyclonal WDR1 antibody raised against the N terminal of WDR1 |
| Gene | DAB2IP |
| Supplier Page | Shop |