ZDHHC16 antibody

Name ZDHHC16 antibody
Supplier Fitzgerald
Catalog 70R-6344
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ZDHHC16 antibody was raised using the N terminal of ZDHHC16 corresponding to a region with amino acids SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
Purity/Format Affinity purified
Blocking Peptide ZDHHC16 Blocking Peptide
Description Rabbit polyclonal ZDHHC16 antibody raised against the N terminal of ZDHHC16
Gene ZDHHC16
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.