| Name | GMPPB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1204 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GMPPB Blocking Peptide |
| Description | Rabbit polyclonal GMPPB antibody raised against the C terminal of GMPPB |
| Gene | GMPPB |
| Supplier Page | Shop |