| Name | CXORF34 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3032 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CXORF34 antibody was raised using the N terminal Of Cxorf34 corresponding to a region with amino acids PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | CXORF34 Blocking Peptide |
| Description | Rabbit polyclonal CXORF34 antibody raised against the N terminal Of Cxorf34 |
| Gene | TRMT2B |
| Supplier Page | Shop |