| Name | ANGPTL5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5404 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT |
| Purity/Format | Affinity purified |
| Blocking Peptide | ANGPTL5 Blocking Peptide |
| Description | Rabbit polyclonal ANGPTL5 antibody raised against the N terminal of ANGPTL5 |
| Gene | ANGPTL5 |
| Supplier Page | Shop |