Name | HBS1L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1943 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | HBS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH |
Purity/Format | Affinity purified |
Blocking Peptide | HBS1L Blocking Peptide |
Description | Rabbit polyclonal HBS1L antibody |
Gene | HBS1L |
Supplier Page | Shop |