| Name | NRARP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3353 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NRARP antibody was raised using the middle region of NRARP corresponding to a region with amino acids QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG |
| Purity/Format | Affinity purified |
| Blocking Peptide | NRARP Blocking Peptide |
| Description | Rabbit polyclonal NRARP antibody raised against the middle region of NRARP |
| Gene | NRARP |
| Supplier Page | Shop |