| Name | ATP5F1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2455 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ATP5F1 antibody was raised using the middle region of ATP5F1 corresponding to a region with amino acids VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATP5F1 Blocking Peptide |
| Description | Rabbit polyclonal ATP5F1 antibody raised against the middle region of ATP5F1 |
| Gene | ATP5F1 |
| Supplier Page | Shop |