Name | KCTD16 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3962 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL |
Purity/Format | Affinity purified |
Blocking Peptide | KCTD16 Blocking Peptide |
Description | Rabbit polyclonal KCTD16 antibody raised against the N terminal of KCTD16 |
Gene | KCTD16 |
Supplier Page | Shop |