Name | NAPE-PLD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3193 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV |
Purity/Format | Affinity purified |
Blocking Peptide | NAPE-PLD Blocking Peptide |
Description | Rabbit polyclonal NAPE-PLD antibody raised against the N terminal Of Nape-Pld |
Gene | NAPEPLD |
Supplier Page | Shop |