NAPE-PLD antibody

Name NAPE-PLD antibody
Supplier Fitzgerald
Catalog 70R-3193
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV
Purity/Format Affinity purified
Blocking Peptide NAPE-PLD Blocking Peptide
Description Rabbit polyclonal NAPE-PLD antibody raised against the N terminal Of Nape-Pld
Gene NAPEPLD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.