| Name | LRRC37B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6920 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LRRC37B antibody was raised using the N terminal of LRRC37B corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC37B Blocking Peptide |
| Description | Rabbit polyclonal LRRC37B antibody raised against the N terminal of LRRC37B |
| Gene | LRRC37B |
| Supplier Page | Shop |