| Name | C4ORF28 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4154 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C4ORF28 antibody was raised using the middle region of C4Orf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C4ORF28 Blocking Peptide |
| Description | Rabbit polyclonal C4ORF28 antibody raised against the middle region of C4Orf28 |
| Gene | PACRGL |
| Supplier Page | Shop |