ATIC antibody

Name ATIC antibody
Supplier Fitzgerald
Catalog 70R-1236
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen ATIC antibody was raised using the N terminal of ATIC corresponding to a region with amino acids YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG
Purity/Format Total IgG Protein A purified
Blocking Peptide ATIC Blocking Peptide
Description Rabbit polyclonal ATIC antibody raised against the N terminal of ATIC
Gene ATIC
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.