| Name | SCOTIN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5982 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCOTIN Blocking Peptide |
| Description | Rabbit polyclonal SCOTIN antibody raised against the middle region of Scotin |
| Gene | SHISA5 |
| Supplier Page | Shop |