| Name | RPS21 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2520 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RPS21 antibody was raised using the middle region of RPS21 corresponding to a region with amino acids NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPS21 Blocking Peptide |
| Description | Rabbit polyclonal RPS21 antibody raised against the middle region of RPS21 |
| Gene | RPS21 |
| Supplier Page | Shop |