| Name | SLC6A14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6568 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLC6A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC6A14 Blocking Peptide |
| Description | Rabbit polyclonal SLC6A14 antibody |
| Gene | SLC6A14 |
| Supplier Page | Shop |