| Name | CSHL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6216 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CSHL1 Blocking Peptide |
| Description | Rabbit polyclonal CSHL1 antibody raised against the C terminal of CSHL1 |
| Gene | CSHL1 |
| Supplier Page | Shop |