| Name | MSRA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3994 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | MSRA Blocking Peptide |
| Description | Rabbit polyclonal MSRA antibody raised against the middle region of MSRA |
| Gene | MSRA |
| Supplier Page | Shop |