ACPL2 antibody

Name ACPL2 antibody
Supplier Fitzgerald
Catalog 70R-6408
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ACPL2 antibody was raised using the N terminal of ACPL2 corresponding to a region with amino acids PSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVA
Purity/Format Affinity purified
Blocking Peptide ACPL2 Blocking Peptide
Description Rabbit polyclonal ACPL2 antibody raised against the N terminal of ACPL2
Gene PXYLP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.