| Name | ANKRD13B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3642 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | ANKRD13B antibody was raised using the middle region of ANKRD13B corresponding to a region with amino acids HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | ANKRD13B Blocking Peptide |
| Description | Rabbit polyclonal ANKRD13B antibody raised against the middle region of ANKRD13B |
| Gene | ANKRD13B |
| Supplier Page | Shop |