| Name | PDZK1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3097 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDZK1 Blocking Peptide |
| Description | Rabbit polyclonal PDZK1 antibody raised against the n terminal of PDZK1 |
| Gene | PDZK1 |
| Supplier Page | Shop |