| Name | KCNB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5114 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNB1 Blocking Peptide |
| Description | Rabbit polyclonal KCNB1 antibody raised against the middle region of KCNB1 |
| Gene | KCNB1 |
| Supplier Page | Shop |