| Name | G3BP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1654 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | G3BP antibody was raised using the N terminal Of G3Bp corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | G3BP Blocking Peptide |
| Description | Rabbit polyclonal G3BP antibody raised against the N terminal Of G3Bp |
| Gene | GBP3 |
| Supplier Page | Shop |