ACADM antibody

Name ACADM antibody
Supplier Fitzgerald
Catalog 70R-1108
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
Purity/Format Total IgG Protein A purified
Blocking Peptide ACADM Blocking Peptide
Description Rabbit polyclonal ACADM antibody raised against the N terminal of ACADM
Gene ACADM
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.