| Name | TXNDC16 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6985 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TXNDC16 Blocking Peptide |
| Description | Rabbit polyclonal TXNDC16 antibody raised against the N terminal of TXNDC16 |
| Gene | TXNDC16 |
| Supplier Page | Shop |