Name | RARA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1301 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids TPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | RARA Blocking Peptide |
Description | Rabbit polyclonal RARA antibody raised against the N terminal of RARA |
Gene | RARA |
Supplier Page | Shop |