| Name | GJA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6088 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE |
| Purity/Format | Affinity purified |
| Blocking Peptide | GJA1 Blocking Peptide |
| Description | Rabbit polyclonal GJA1 antibody raised against the N terminal of GJA1 |
| Gene | GJA1 |
| Supplier Page | Shop |