| Name | C17ORF64 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3321 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C17ORF64 antibody was raised using the middle region of C17Orf64 corresponding to a region with amino acids NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE |
| Purity/Format | Affinity purified |
| Blocking Peptide | C17ORF64 Blocking Peptide |
| Description | Rabbit polyclonal C17ORF64 antibody raised against the middle region of C17Orf64 |
| Gene | C17orf64 |
| Supplier Page | Shop |