| Name | SLC30A1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7370 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLC30A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC30A1 Blocking Peptide |
| Description | Rabbit polyclonal SLC30A1 antibody |
| Gene | SLC30A1 |
| Supplier Page | Shop |