| Name | PIGV antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1879 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PIGV Blocking Peptide |
| Description | Rabbit polyclonal PIGV antibody raised against the N terminal of PIGV |
| Gene | PIGV |
| Supplier Page | Shop |